ZMAT5 Peptide - C-terminal region
ZMAT5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZMAT5
UniProt
Q9UDW3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZMAT5 Rabbit Polyclonal Antibody (orb583530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005261740
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![USP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]](https://cdn.genprice.uk/products/937/68dd1b64061270361ea1392a/imageurl/ta500327am.webp)
TA500327AM 100 µL
USP13 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]
Sign In for Pricing
View Details 
![PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]](https://cdn.genprice.uk/products/763/68dd14a6061270361e7d1ba8/imageurl/e-ab-f09742j.webp)
E-AB-F09742J-01 20 Tests
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
Sign In for Pricing
View Details E-AB-F09742J-02 100 Tests
PerCP/Cyanine5.5 Rat IgG2a, λ Isotype Control[B39-4]
Sign In for Pricing
View Details