ZMAT5 Peptide - C-terminal region
ZMAT5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZMAT5
UniProt
Q9UDW3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZMAT5 Rabbit Polyclonal Antibody (orb583530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005261740
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-M0735-01 24 Tests
Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit
Sign In for Pricing
View Details E-EL-M0735-02 48 Tests
Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit
Sign In for Pricing
View Details E-EL-M0735-03 96 Tests
Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit
Sign In for Pricing
View Details 