SDR39U1 Peptide - middle region
SDR39U1 Peptide - middle region
Product Specifications
Product Name Alternative
SDR39U1, C14orf124, HCDI
UniProt
Q9NRG7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SDR39U1 Rabbit Polyclonal Antibody (orb583538) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064580
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAARLPGDST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-CHRNa7-Hu-01 96 Tests
Human Cholinergic Receptor, Nicotinic, Alpha 7 (CHRNa7) ELISA Kit
Sign In for Pricing
View Details RD-CHRNa7-Hu-02 48 Tests
Human Cholinergic Receptor, Nicotinic, Alpha 7 (CHRNa7) ELISA Kit
Sign In for Pricing
View Details 
BNC740197-100 1x 100 µL
FOXP3 (FXP3/197), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details