Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTWD1 Peptide - N-terminal region

DTWD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DTWD1, MDS009

UniProt

Q8N5C7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DTWD1 Rabbit Polyclonal Antibody (orb583541) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005254619

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hadhb protein
orb605096-01 20 µg

Mouse Hadhb protein

Sign In for Pricing
View Details
Mouse Hadhb protein
orb605096-02 100 µg

Mouse Hadhb protein

Sign In for Pricing
View Details
Mouse Hadhb protein
orb605096-03 1 mg

Mouse Hadhb protein

Sign In for Pricing
View Details
Alx3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6378903 1.0 µg DNA

Alx3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Monkey I-PTH-intact Parathormone- ELISA Kit
E-EL-MK0697-01 24 Tests

Monkey I-PTH-intact Parathormone- ELISA Kit

Sign In for Pricing
View Details
Monkey I-PTH-intact Parathormone- ELISA Kit
E-EL-MK0697-02 48 Tests

Monkey I-PTH-intact Parathormone- ELISA Kit

Sign In for Pricing
View Details