MOAP1 Peptide - C-terminal region
MOAP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MOAP1, PNMA4
UniProt
Q96BY2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MOAP1 Rabbit Polyclonal Antibody (orb583634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071434
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7562205 3x 1.0 µg
Zfp689 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details VAng-2583Lsx-100g 100 µg
Human Nectin-2 Protein (Gln 32-Leu 360) [Mouse IgG2a Fc tag]
Sign In for Pricing
View Details 
122841-ML490 100 µL
ACAA2 (Acetyl Coenzyme A Acyltransferase 2, Acetyl CoA Acyltransferase 2, 3-ketoacyl CoA Thiolase Mitochondrial, Beta Ketothiolase, DSAEC, Mitochondrial 3-oxoacyl Coenzyme A Thiolase, Mitochondrial 3-oxoacyl-CoA Thiolase, T1) (MaxLight 490)
Sign In for Pricing
View Details