MOAP1 Peptide - C-terminal region
MOAP1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MOAP1, PNMA4
UniProt
Q96BY2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MOAP1 Rabbit Polyclonal Antibody (orb583634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071434
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV758803 1.0 µg DNA
CDY17P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 
56609141 1x 10^6 Cells / 1.0 mL
DOC2BL CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details MBS542685-01 0.25 mg
CD3 epsilon Antibody Antigenic Blocking Peptide
Sign In for Pricing
View Details 
MBS542685-02 5x 0.25 mg
CD3 epsilon Antibody Antigenic Blocking Peptide
Sign In for Pricing
View Details H6099-96J-ML405 100 µL
HLA Class 2 Antigen DR (HLA DR) (MaxLight 405) discontinued
Sign In for Pricing
View Details