EML4 Peptide - C-terminal region
EML4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EML4, C2orf2, EMAPL4
UniProt
Q9HC35
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EML4 Rabbit Polyclonal Antibody (orb585066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061936
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNEISKEQAKATLLED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Y14 (RBM8A) Mouse Monoclonal Antibody [Clone ID: OTI10B5]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d6c/imageurl/cf812498.webp)
CF812498 100 µg
Y14 (RBM8A) Mouse Monoclonal Antibody [Clone ID: OTI10B5]
Sign In for Pricing
View Details 