Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EML4 Peptide - C-terminal region

EML4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EML4, C2orf2, EMAPL4

UniProt

Q9HC35

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EML4 Rabbit Polyclonal Antibody (orb585066) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061936

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNEISKEQAKATLLED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorene-13C6
TRC-F462002-1MG 1 mg

Fluorene-13C6

Sign In for Pricing
View Details
Prasterone Enanthate
TRC-D494015-50MG 50 mg

Prasterone Enanthate

Sign In for Pricing
View Details
NUDT2 (NM_001161) Human Over-expression Lysate
LY420095 100 µg

NUDT2 (NM_001161) Human Over-expression Lysate

Sign In for Pricing
View Details
ALDH1L2 (NM_001034173) Human Over-expression Lysate
LC421958 20 µg

ALDH1L2 (NM_001034173) Human Over-expression Lysate

Sign In for Pricing
View Details
RAI2 (NM_001172732) Human Over-expression Lysate
LC433148 20 µg

RAI2 (NM_001172732) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human RCN2 (C-6His)
PKSH034035-01 10 µg

Recombinant Human RCN2 (C-6His)

Sign In for Pricing
View Details