Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSD1 Peptide - C-terminal region

FSD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FSD1, GLFND, MIR1, VLP27

UniProt

Q9BTV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSD1 Rabbit Polyclonal Antibody (orb331168) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077309

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRCLQKRGSATSSSNTSLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrrc20 (NM_153542) Mouse Tagged ORF Clone
MG201700 10 µg

Lrrc20 (NM_153542) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sulfo-N-succinimidyl (N-Iodoacetyl)aminobenzoate Sodium 90%
TRC-S732000-5MG 5 mg

Sulfo-N-succinimidyl (N-Iodoacetyl)aminobenzoate Sodium 90%

Sign In for Pricing
View Details
FRG2B (NM_001080998) Human Over-expression Lysate
LC421146 20 µg

FRG2B (NM_001080998) Human Over-expression Lysate

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (3F1), 0.2mg/mL
BNUB2029-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (3F1), 0.2mg/mL

Sign In for Pricing
View Details
CDw75 (LN-1), 1mg/mL
BNUM0055-50 1x 50 µL

CDw75 (LN-1), 1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD24 Antibody[ML5]
E-AB-F1147I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD24 Antibody[ML5]

Sign In for Pricing
View Details