Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSD1 Peptide - C-terminal region

FSD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FSD1, GLFND, MIR1, VLP27

UniProt

Q9BTV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSD1 Rabbit Polyclonal Antibody (orb331168) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077309

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRCLQKRGSATSSSNTSLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eppendorf Tubes (50)
TEPP-50 50 Tests

Eppendorf Tubes (50)

Sign In for Pricing
View Details
Sphingomyelin (SM) Fluorometric Assay Kit
E-BC-F079 96 T (40 samples)

Sphingomyelin (SM) Fluorometric Assay Kit

Sign In for Pricing
View Details
ZXDB Human Gene Knockout Kit (CRISPR)
KN419534 1 Kit

ZXDB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RC-4757-01 50 μL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RC-4757-02 100 µL

Recombinant PON1 Antibody

Sign In for Pricing
View Details
Recombinant PON1 Antibody
RC-4757-03 1 mL

Recombinant PON1 Antibody

Sign In for Pricing
View Details