RASAL1 Peptide - middle region
RASAL1 Peptide - middle region
Product Specifications
Product Name Alternative
RASAL1, RASAL
UniProt
O95294
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASAL1 Rabbit Polyclonal Antibody (orb331179) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLGRTRRISFKGALSEEQMRETSLGLLTGYLGPIVDAIVGSVGRCPPAMR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC420273 20 µg
ATP6V0E2 (NM_001100592) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-AB-20966-01 20 µL
Phospho-PI 3 kinase p85 alpha /gamma (Tyr467/199) Polyclonal Antibody
Sign In for Pricing
View Details E-AB-20966-02 60 µL
Phospho-PI 3 kinase p85 alpha /gamma (Tyr467/199) Polyclonal Antibody
Sign In for Pricing
View Details E-AB-20966-03 120 µL
Phospho-PI 3 kinase p85 alpha /gamma (Tyr467/199) Polyclonal Antibody
Sign In for Pricing
View Details