Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTROB Peptide - C-terminal region

CNTROB Peptide - C-terminal region

Product Specifications

Product Name Alternative

CNTROB, LIP8, PP1221

UniProt

Q8N137

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CNTROB Rabbit Polyclonal Antibody (orb585283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EANQLLSTTLPPPNPPAPPAGPSSPGPQEPEKEERRVWTMPPMAVALKPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCR4-TOPO-CCDC169 Plasmid
PVT33151 2 µg

pCR4-TOPO-CCDC169 Plasmid

Sign In for Pricing
View Details
SLC18A3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
43917126 3x 1.0µg DNA

SLC18A3 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit Interleukin 18 (IL18) ELISA Kit
RD-IL18-Rb-48Tests 48 Tests

Rabbit Interleukin 18 (IL18) ELISA Kit

Sign In for Pricing
View Details
Jumonji Rabbit Monoclonal Antibody
orb3072730-01 30 µL

Jumonji Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Jumonji Rabbit Monoclonal Antibody
orb3072730-02 50 µL

Jumonji Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Jumonji Rabbit Monoclonal Antibody
orb3072730-03 100 µL

Jumonji Rabbit Monoclonal Antibody

Sign In for Pricing
View Details