Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC5 Peptide - N-terminal region

THOC5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

THOC5, C22orf19, KIAA0983

UniProt

Q13769

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THOC5 Rabbit Polyclonal Antibody (orb585302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003669

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL6, ID (METTL6, Methyltransferase-like protein 6) (MaxLight 550) discontinued
038390-ML550 100 µL

METTL6, ID (METTL6, Methyltransferase-like protein 6) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ATG4A Rabbit Polyclonal Antibody (FITC)
orb2596233 100 µg

ATG4A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Nuclear Factor, Erythroid Derived 2 Like 2 (NFE2L2) Antibody
abx177838-01 100 µL

Nuclear Factor, Erythroid Derived 2 Like 2 (NFE2L2) Antibody

Sign In for Pricing
View Details
Nuclear Factor, Erythroid Derived 2 Like 2 (NFE2L2) Antibody
abx177838-02 200 µL

Nuclear Factor, Erythroid Derived 2 Like 2 (NFE2L2) Antibody

Sign In for Pricing
View Details
Nuclear Factor, Erythroid Derived 2 Like 2 (NFE2L2) Antibody
abx177838-03 1 mL

Nuclear Factor, Erythroid Derived 2 Like 2 (NFE2L2) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Lgr5/GPR49 Antibody [Alexa Fluor 488]
NBP1-28904AF488 0.1 mL

Rabbit Polyclonal Lgr5/GPR49 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details