Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC5 Peptide - N-terminal region

THOC5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

THOC5, C22orf19, KIAA0983

UniProt

Q13769

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THOC5 Rabbit Polyclonal Antibody (orb585302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003669

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMMT Rabbit Polyclonal Antibody
E28PN2899 100 µL

IMMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
R3HDM2 (m) -PR
sc-152623-PR 10 µM - 20 µL

R3HDM2 (m) -PR

Sign In for Pricing
View Details
Mouse Monoclonal CD19 Antibody (CB19) [Janelia Fluor 646]
NBP2-25196JF646 0.1 mL

Mouse Monoclonal CD19 Antibody (CB19) [Janelia Fluor 646]

Sign In for Pricing
View Details
RPS6 Protein Vector (Human) (pPM-C-His)
PV036280 500 ng

RPS6 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Sp-2′-AHA-cAMP
BLG-A068-25 5x 5 μmoL

Sp-2′-AHA-cAMP

Sign In for Pricing
View Details
INTROL TB Panel M114plus
M114Plus 12 x 1 mL

INTROL TB Panel M114plus

Sign In for Pricing
View Details