Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT7 Peptide - C-terminal region

ACOT7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACOT7, BACH

UniProt

O00154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOT7 Rabbit Polyclonal Antibody (orb585304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AY761185 Adenovirus (Mouse)
12904054 1.0 mL

AY761185 Adenovirus (Mouse)

Sign In for Pricing
View Details
Claudin 8 antibody
MBS5300205-01 0.1 mL

Claudin 8 antibody

Sign In for Pricing
View Details
Claudin 8 antibody
MBS5300205-02 5x 0.1 mL

Claudin 8 antibody

Sign In for Pricing
View Details
TRAJ44 3'UTR Luciferase Stable Cell Line
TU026261 1.0 mL

TRAJ44 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Feline Proenkephalin-A (PENK)
AP2C184-01 1 mg

Recombinant Feline Proenkephalin-A (PENK)

Sign In for Pricing
View Details
Recombinant Feline Proenkephalin-A (PENK)
AP2C184-02 100 µg

Recombinant Feline Proenkephalin-A (PENK)

Sign In for Pricing
View Details