Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT7 Peptide - C-terminal region

ACOT7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACOT7, BACH

UniProt

O00154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOT7 Rabbit Polyclonal Antibody (orb585304) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Novyi apt Protein (aa 1-172)
VAng-Lsx9895-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Novyi apt Protein (aa 1-172)

Sign In for Pricing
View Details
Cyp2c11 (NM_019184) Rat Tagged ORF Clone Lentiviral Particle
RR208107L4V 200 µL

Cyp2c11 (NM_019184) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Rat ACTR3 Protein, His (Fc)-Avi-tagged
ACTR3-146R 50 µg

Recombinant Rat ACTR3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Mouse Ndufv2 ELISA KIT
ELI-44717m 96 Tests

Mouse Ndufv2 ELISA KIT

Sign In for Pricing
View Details
Rabbit Polyclonal HDAC1 Antibody
NB100-56340SS 0.025 mg

Rabbit Polyclonal HDAC1 Antibody

Sign In for Pricing
View Details
CD11a antibody (biotin)
61R-CD11aaHUBT 100 tests

CD11a antibody (biotin)

Sign In for Pricing
View Details