PPP6C Peptide - C-terminal region
PPP6C Peptide - C-terminal region
Product Specifications
Product Name Alternative
PPP6C, PPP6
UniProt
O00743
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP6C Rabbit Polyclonal Antibody (orb585332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002712
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882026-500 1x 500 µL
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP26075PU-N 100 µL
PKM2 (PKM) (Isoform M1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
PKSH033508-01 10 µg
Recombinant Human CD3d/CD3 delta Protein (His Tag)
Sign In for Pricing
View Details PKSH033508-02 50 µg
Recombinant Human CD3d/CD3 delta Protein (His Tag)
Sign In for Pricing
View Details 
