Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP6C Peptide - C-terminal region

PPP6C Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPP6C, PPP6

UniProt

O00743

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP6C Rabbit Polyclonal Antibody (orb585332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002712

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Cartilage
CS631038 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
1-(3,5-Di-tert-butyl-4-hydroxyphenyl)-1,2-ethanediol
TRC-D125650-5MG 5 mg

1-(3,5-Di-tert-butyl-4-hydroxyphenyl)-1,2-ethanediol

Sign In for Pricing
View Details
Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF647 conjugate, 0.1mg/mL
BNC471665-100 1x 100 µL

Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details