Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAT3 Peptide - N-terminal region

ADAT3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADAT3, TAD3

UniProt

Q96EY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAT3 Rabbit Polyclonal Antibody (orb585334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-TAG-72 Antibody
HY000242 0.1 mL

SensiStain™ Anti-TAG-72 Antibody

Sign In for Pricing
View Details
N-Boc L-Serine Beta-Lactone
TRC-B667390-250MG 250 mg

N-Boc L-Serine Beta-Lactone

Sign In for Pricing
View Details
Ecgonine Ethyl Ester
TRC-E325570-10MG 10 mg

Ecgonine Ethyl Ester

Sign In for Pricing
View Details
Soluble Sugar Microplate Assay Kit
RDSM171 100 Assays

Soluble Sugar Microplate Assay Kit

Sign In for Pricing
View Details
DLX4 (NM_138281) Human Recombinant Protein
TP760063 50 µg

DLX4 (NM_138281) Human Recombinant Protein

Sign In for Pricing
View Details
SIGLEC1 Antibody (Biotin)
KB-26876-01 50 μL

SIGLEC1 Antibody (Biotin)

Sign In for Pricing
View Details