ADAT3 Peptide - N-terminal region
ADAT3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ADAT3, TAD3
UniProt
Q96EY9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADAT3 Rabbit Polyclonal Antibody (orb585334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PLA2G3 Mouse Monoclonal Antibody [Clone ID: OTI8G8]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908b9b/imageurl/cf811660.webp)
CF811660 100 µg
PLA2G3 Mouse Monoclonal Antibody [Clone ID: OTI8G8]
Sign In for Pricing
View Details 
BNC681816-100 1x 100 µL
Histone H1 (Pan Nuclear Marker) (N/A), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP318843 20 µg
NIPP1 (PPP1R8) (NM_014110) Human Recombinant Protein
Sign In for Pricing
View Details 