Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGER1 Peptide - C-terminal region

PTGER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTGER1

UniProt

P34995

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGER1 Rabbit Polyclonal Antibody (orb585646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000946

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Heterodontus francisci Myelin protein P0 (mpz)
MBS1246535 Inquire

Recombinant Heterodontus francisci Myelin protein P0 (mpz)

Sign In for Pricing
View Details
Recombinant Human RBM5, GST-tagged
RBM5-2217H 25 µg

Recombinant Human RBM5, GST-tagged

Sign In for Pricing
View Details
Smim12 Mouse shRNA Lentiviral Particle (Locus ID 80284)
TL505332V 500 µL Each

Smim12 Mouse shRNA Lentiviral Particle (Locus ID 80284)

Sign In for Pricing
View Details
KCNJ9 Human shRNA Plasmid Kit (Locus ID 3765)
TR312004 1 Kit

KCNJ9 Human shRNA Plasmid Kit (Locus ID 3765)

Sign In for Pricing
View Details
CCP110 Conjugated Antibody
C46945 100 µL

CCP110 Conjugated Antibody

Sign In for Pricing
View Details
NRL Recombinant Protein (Rat)
RP214553 100 µg

NRL Recombinant Protein (Rat)

Sign In for Pricing
View Details