Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGER1 Peptide - C-terminal region

PTGER1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTGER1

UniProt

P34995

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGER1 Rabbit Polyclonal Antibody (orb585646) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000946

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG protein (FITC)
MBS538968-01 1 mg

Human IgG protein (FITC)

Sign In for Pricing
View Details
Human IgG protein (FITC)
MBS538968-02 5x 1 mg

Human IgG protein (FITC)

Sign In for Pricing
View Details
Rac-irofulven discontinued. See 014958
288821-01 1 mg

Rac-irofulven discontinued. See 014958

Sign In for Pricing
View Details
Rac-irofulven discontinued. See 014958
288821-02 2 mg

Rac-irofulven discontinued. See 014958

Sign In for Pricing
View Details
Rac-irofulven discontinued. See 014958
288821-03 5 mg

Rac-irofulven discontinued. See 014958

Sign In for Pricing
View Details
Rac-irofulven discontinued. See 014958
288821-04 10 mg

Rac-irofulven discontinued. See 014958

Sign In for Pricing
View Details