Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACKR3 Peptide - C-terminal region

ACKR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACKR3, CMKOR1, CXCR7, GPR159, RDC1

UniProt

P25106

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACKR3 Rabbit Polyclonal Antibody (orb326477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005246155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS803597 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Bis(2-chloroethyl) (2-Chloroethyl)phosphonate (>80%)
TRC-B825605-10MG 10 mg

Bis(2-chloroethyl) (2-Chloroethyl)phosphonate (>80%)

Sign In for Pricing
View Details
alpha 1 Antichymotrypsin (SERPINA3) (NM_001085) Human Over-expression Lysate
LY421268 100 µg

alpha 1 Antichymotrypsin (SERPINA3) (NM_001085) Human Over-expression Lysate

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), 0.2mg/mL
BNUB0354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS622183 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details
EBNA1 binding protein 2 (EBNA1BP2) (C-term) Rabbit Polyclonal Antibody
AP51355PU-N 400 µL

EBNA1 binding protein 2 (EBNA1BP2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details