Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACKR3 Peptide - C-terminal region

ACKR3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACKR3, CMKOR1, CXCR7, GPR159, RDC1

UniProt

P25106

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACKR3 Rabbit Polyclonal Antibody (orb326477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005246155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADK Antibody
KC-3450-01 50 μL

ADK Antibody

Sign In for Pricing
View Details
ADK Antibody
KC-3450-02 100 µL

ADK Antibody

Sign In for Pricing
View Details
ADK Antibody
KC-3450-03 1 mL

ADK Antibody

Sign In for Pricing
View Details
Benoxinate Hydrochloride
TRC-B161400-5G 5 g

Benoxinate Hydrochloride

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994T-01 50 Tests

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]
E-AB-F0994T-02 100 Tests

Elab Fluor® Violet 610 Anti-Mouse CD86 Antibody[GL-1]

Sign In for Pricing
View Details