Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAM1 Peptide - middle region

SPAM1 Peptide - middle region

Product Specifications

Product Name Alternative

SPAM1, HYAL3, PH20

UniProt

P38567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAM1 Rabbit Polyclonal Antibody (orb585916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694859

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Hydroxylysine ELISA
GTR10414592 96 Well

Monkey Hydroxylysine ELISA

Sign In for Pricing
View Details
AKR1C3 Rabbit Polyclonal Antibody (PE)
orb2598638 100 µg

AKR1C3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Recombinant Mouse CCL24
PEM0254-01 10 µg

Recombinant Mouse CCL24

Sign In for Pricing
View Details
Recombinant Mouse CCL24
PEM0254-02 50 µg

Recombinant Mouse CCL24

Sign In for Pricing
View Details
Recombinant Mouse CCL24
PEM0254-03 500 µg

Recombinant Mouse CCL24

Sign In for Pricing
View Details
FBP2 Polyclonal Antibody
E44H02598 100 µL

FBP2 Polyclonal Antibody

Sign In for Pricing
View Details