Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAM1 Peptide - middle region

SPAM1 Peptide - middle region

Product Specifications

Product Name Alternative

SPAM1, HYAL3, PH20

UniProt

P38567

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAM1 Rabbit Polyclonal Antibody (orb585916) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694859

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQQNVQLSLTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xaa-Pro dipeptidase
AP86729 1 mg

Xaa-Pro dipeptidase

Sign In for Pricing
View Details
FBXO25 siRNA (h)
sc-77570 10 µM

FBXO25 siRNA (h)

Sign In for Pricing
View Details
2'-Hydroxyacetophenone-d4 Oxime Acetate
MBS6059539-01 2.5 mg

2'-Hydroxyacetophenone-d4 Oxime Acetate

Sign In for Pricing
View Details
2'-Hydroxyacetophenone-d4 Oxime Acetate
MBS6059539-02 5x 2.5 mg

2'-Hydroxyacetophenone-d4 Oxime Acetate

Sign In for Pricing
View Details
Aurora B/AIM1 Antibody [M7F7]
C21107-50uL 50 μL

Aurora B/AIM1 Antibody [M7F7]

Sign In for Pricing
View Details
Myosin light chain (phospho S20) Rabbit pAb, IRDye 800CW conjugated
orb2891168 100 µL

Myosin light chain (phospho S20) Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details