Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT12 Peptide - N-terminal region

KRT12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KRT12

UniProt

Q99456

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT12 Rabbit Polyclonal Antibody (orb333741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000214

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF405S conjugate, 0.1mg/mL
BNC042267-500 1x 500 µL

Cell Division Cycle 34 homolog (CPTC-CDC34-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SSB Antibody
F48218-0.4ML 0.4 mL

SSB Antibody

Sign In for Pricing
View Details
Acenaphthylene
TRC-A130750-250MG 250 mg

Acenaphthylene

Sign In for Pricing
View Details
Creatine Kinase-BB (CK-BB) (CKBB/1268), Biotin conjugate, 0.1mg/mL
BNCB1268-500 1x 500 µL

Creatine Kinase-BB (CK-BB) (CKBB/1268), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp638 Mouse Gene Knockout Kit (CRISPR)
KN519712 1 Kit

Zfp638 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isoconazole
TRC-I212750-1MG 1 mg

Isoconazole

Sign In for Pricing
View Details