Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT12 Peptide - N-terminal region

KRT12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

KRT12

UniProt

Q99456

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT12 Rabbit Polyclonal Antibody (orb333741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000214

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYYPLIEDLRNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GremLin 1 (GREM1) activation kit by CRISPRa
GA108913 1 Kit

Human GremLin 1 (GREM1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR562715 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800419 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS802746 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Valencene (>85%)
TRC-V915233-250MG 250 mg

Valencene (>85%)

Sign In for Pricing
View Details
Ganaxolone
TRC-G235005-2.5G 2.5 g

Ganaxolone

Sign In for Pricing
View Details