FHIT Peptide - C-terminal region
FHIT Peptide - C-terminal region
Product Specifications
Product Name Alternative
FHIT
UniProt
P49789
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FHIT Rabbit Polyclonal Antibody (orb588102) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005265010
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ICH1196-100mg 100 mg
Anti-Mouse CD134 (OX-86) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
BNC401395-500 1x 500 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
