Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT Peptide - C-terminal region

FHIT Peptide - C-terminal region

Product Specifications

Product Name Alternative

FHIT

UniProt

P49789

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FHIT Rabbit Polyclonal Antibody (orb588102) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005265010

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (CLIP/813), CF568 conjugate, 0.1mg/mL
BNC680813-500 1x 500 µL

CD74 (CLIP/813), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sudan I (SUD) ELISA Kit
RDF-E016 96 Tests

Sudan I (SUD) ELISA Kit

Sign In for Pricing
View Details
YY1 Monoclonal Antibody
AN005360L-01 25 µL

YY1 Monoclonal Antibody

Sign In for Pricing
View Details
YY1 Monoclonal Antibody
AN005360L-02 100 µL

YY1 Monoclonal Antibody

Sign In for Pricing
View Details
SAR1B (NM_016103) Human Recombinant Protein
TP310593M 100 µg

SAR1B (NM_016103) Human Recombinant Protein

Sign In for Pricing
View Details
Cyanine 3.5 acid [equivalent to Cy3.5® acid]
147-AAT 5 mg

Cyanine 3.5 acid [equivalent to Cy3.5® acid]

Sign In for Pricing
View Details