AKR1A1 Peptide - N-terminal region
AKR1A1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AKR1A1, ALDR1, ALR
UniProt
P14550
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKR1A1 Rabbit Polyclonal Antibody (orb331469) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_697021
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHYKET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680158-100 1x 100 µL
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040008-100 1x 100 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680984-100 1x 100 µL
P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details