Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMHR2 Peptide - N-terminal region

AMHR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMHR2, AMHR, MISR2

UniProt

Q16671

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMHR2 Rabbit Polyclonal Antibody (orb588208) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065434

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B3 (NM_000197) Human Over-expression Lysate
LY424871 100 µg

HSD17B3 (NM_000197) Human Over-expression Lysate

Sign In for Pricing
View Details
(S)-3-Amino-1-(tert-butoxycarbonyl)piperidine-3-carboxylicacid
TRC-S296850-500MG 500 mg

(S)-3-Amino-1-(tert-butoxycarbonyl)piperidine-3-carboxylicacid

Sign In for Pricing
View Details
(R)-6-Bromo Phenylephrine Hydrochloride
TRC-B686830-1MG 1 mg

(R)-6-Bromo Phenylephrine Hydrochloride

Sign In for Pricing
View Details
CD74 (B-Cell Marker) (CLIP/3127R), CF405S conjugate, 0.1mg/mL
BNC043127-500 1x 500 µL

CD74 (B-Cell Marker) (CLIP/3127R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EHMT1/GLP (EHMT1) Rabbit Polyclonal Antibody
AP11093PU-N 400 µL

EHMT1/GLP (EHMT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chromium Picolinate
TRC-C432745-5G 5 g

Chromium Picolinate

Sign In for Pricing
View Details