Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASH2L Peptide - middle region

ASH2L Peptide - middle region

Product Specifications

Product Name Alternative

ASH2L, ASH2L1

UniProt

Q9UBL3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASH2L Rabbit Polyclonal Antibody (orb588214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004665

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: left
CB531193 1 Block

Frozen Tissue Blocks, Colon: left

Sign In for Pricing
View Details
ExoBriteTM 645/675 True EV Membrane Stain, 500 labelings
#30137 1x 500 µL

ExoBriteTM 645/675 True EV Membrane Stain, 500 labelings

Sign In for Pricing
View Details
p-Chlorobenzyl Bromide-d6
TRC-C365997-5MG 5 mg

p-Chlorobenzyl Bromide-d6

Sign In for Pricing
View Details
PRHOXNB (URAD) (NM_001105577) Human Over-expression Lysate
LY426287 100 µg

PRHOXNB (URAD) (NM_001105577) Human Over-expression Lysate

Sign In for Pricing
View Details
EVA1C Human Gene Knockout Kit (CRISPR)
KN424827 1 Kit

EVA1C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Formylbenzenesulfonic Acid
TRC-F754725-500MG 500 mg

4-Formylbenzenesulfonic Acid

Sign In for Pricing
View Details