Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASH2L Peptide - middle region

ASH2L Peptide - middle region

Product Specifications

Product Name Alternative

ASH2L, ASH2L1

UniProt

Q9UBL3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASH2L Rabbit Polyclonal Antibody (orb588214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004665

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd247 Hamster Monoclonal Antibody [Clone ID: H146-968]
AM12004PU-N 250 µg

Cd247 Hamster Monoclonal Antibody [Clone ID: H146-968]

Sign In for Pricing
View Details
MRC2 Rabbit Monoclonal Antibody
TA423572 100 µL

MRC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Interleukin 34 (IL34) (NM_152456) Human Over-expression Lysate
LC403469 20 µg

Interleukin 34 (IL34) (NM_152456) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Galectin-14 protein (N-His)
PKSH034189-01 20 µg

Recombinant Human Galectin-14 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human Galectin-14 protein (N-His)
PKSH034189-02 100 µg

Recombinant Human Galectin-14 protein (N-His)

Sign In for Pricing
View Details
D,L-Azetidine-2-carboxylic Acid-d4
TRC-A812492-1MG 1 mg

D,L-Azetidine-2-carboxylic Acid-d4

Sign In for Pricing
View Details