Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASS1 Peptide - middle region

ASS1 Peptide - middle region

Product Specifications

Product Name Alternative

ASS1, ASS

UniProt

P00966

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASS1 Rabbit Polyclonal Antibody (orb588215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005272257

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N⁶- (2- Methylbutyl) adenosine- 5'- O- triphosphate (6- (2-MeBu) -ATP), sodium salt
M 029-05 5 µmol ~ 2.9 mg

N⁶- (2- Methylbutyl) adenosine- 5'- O- triphosphate (6- (2-MeBu) -ATP), sodium salt

Sign In for Pricing
View Details
BCS1L Antibody
MBS7045390-01 0.05 mL

BCS1L Antibody

Sign In for Pricing
View Details
BCS1L Antibody
MBS7045390-02 0.1 mL

BCS1L Antibody

Sign In for Pricing
View Details
BCS1L Antibody
MBS7045390-03 5x 0.1 mL

BCS1L Antibody

Sign In for Pricing
View Details
Adipose Visceral Diabetic Disease Lysate
20-104 0.1 mg

Adipose Visceral Diabetic Disease Lysate

Sign In for Pricing
View Details
Recombinant Human ASAH1 protein
MBS1561978-01 0.05 mg

Recombinant Human ASAH1 protein

Sign In for Pricing
View Details