Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASS1 Peptide - middle region

ASS1 Peptide - middle region

Product Specifications

Product Name Alternative

ASS1, ASS

UniProt

P00966

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASS1 Rabbit Polyclonal Antibody (orb588215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005272257

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Paraformaldehyde, 4% in PBS Ready-to-Use Fixative
#22023 5x 20 mL

Paraformaldehyde, 4% in PBS Ready-to-Use Fixative

Sign In for Pricing
View Details
CREB1 Protein Vector (Mouse) (pPM-C-HA)
16809024 500 ng

CREB1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
LightNing® BglII
EG15591S 100 Reactions - 1000 U

LightNing® BglII

Sign In for Pricing
View Details
CHP2 (M136) polyclonal antibody
orb643969-01 25 µL

CHP2 (M136) polyclonal antibody

Sign In for Pricing
View Details
CHP2 (M136) polyclonal antibody
orb643969-02 50 μL

CHP2 (M136) polyclonal antibody

Sign In for Pricing
View Details
CHP2 (M136) polyclonal antibody
orb643969-03 100 µL

CHP2 (M136) polyclonal antibody

Sign In for Pricing
View Details