Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASS1 Peptide - middle region

ASS1 Peptide - middle region

Product Specifications

Product Name Alternative

ASS1, ASS

UniProt

P00966

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASS1 Rabbit Polyclonal Antibody (orb588215) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005272257

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDGTTHQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAP2 Rabbit pAb
E45R29949N-50 50 µL

TAP2 Rabbit pAb

Sign In for Pricing
View Details
OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B) (AP) discontinued
130703-AP 100 µL

OIP5 (Protein Mis18-beta, Cancer/Testis Antigen 86, CT86, Opa-interacting Protein 5, OIP-5, MIS18B) (AP) discontinued

Sign In for Pricing
View Details
RAB21 Mouse Monoclonal Antibody [Clone ID: OTI6G3]
TA505719S 30 µL

RAB21 Mouse Monoclonal Antibody [Clone ID: OTI6G3]

Sign In for Pricing
View Details
HIST1H3A Antibody
orb416489-01 50 μL

HIST1H3A Antibody

Sign In for Pricing
View Details
HIST1H3A Antibody
orb416489-02 100 µL

HIST1H3A Antibody

Sign In for Pricing
View Details
ZBTB1 3'UTR GFP Stable Cell Line
TU078708 1.0 mL

ZBTB1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details