Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF2 Peptide - C-terminal region

ATF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATF2, CREB2, CREBP1

UniProt

P15336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF2 Rabbit Polyclonal Antibody (orb588216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1E Protein Vector (Mouse) (pPM-C-HA)
PV168428 500 ng

CSNK1E Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
TRV-0051999-01 20 µL

Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)

Sign In for Pricing
View Details
Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
TRV-0051999-02 100 µL

Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)

Sign In for Pricing
View Details
Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
TRV-0051999-03 200 µL

Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)

Sign In for Pricing
View Details
Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
TRV-0051999-04 1 mL

Polyclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF640R conjugate, 0.1mg/mL
BNC402883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details