Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF2 Peptide - C-terminal region

ATF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATF2, CREB2, CREBP1

UniProt

P15336

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF2 Rabbit Polyclonal Antibody (orb588216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Turk’s Solution
G2950 100 mL

Turk’s Solution

Sign In for Pricing
View Details
Goat Nitric Oxide Synthase Interacting Protein ELISA Kit
MBS103408 Inquire

Goat Nitric Oxide Synthase Interacting Protein ELISA Kit

Sign In for Pricing
View Details
RPL3P12 sgRNA CRISPR Lentivector (Human) (Target 1)
K1874102 1.0 µg DNA

RPL3P12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ADAMTS-5 Inhibitor
C01323-25mg 25 mg

ADAMTS-5 Inhibitor

Sign In for Pricing
View Details
NEDD8 Activating Enzyme E1 Subunit 1 Human Recombinant
rAP-1383 1 Each

NEDD8 Activating Enzyme E1 Subunit 1 Human Recombinant

Sign In for Pricing
View Details
Rno-miR-505-5p miRNA Antagomir
CIS0501-01 10 nmol

Rno-miR-505-5p miRNA Antagomir

Sign In for Pricing
View Details