Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF7 Peptide - middle region

ATF7 Peptide - middle region

Product Specifications

Product Name Alternative

ATF7, ATFA

UniProt

P17544

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF7 Rabbit Polyclonal Antibody (orb331473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Ethyl-1H-1,2,3-benzotriazole
DAA66326-01 50 mg

6-Ethyl-1H-1,2,3-benzotriazole

Sign In for Pricing
View Details
6-Ethyl-1H-1,2,3-benzotriazole
DAA66326-02 0.5 g

6-Ethyl-1H-1,2,3-benzotriazole

Sign In for Pricing
View Details
L12R1 Rabbit pAb, PE-Cy7 conjugated
orb2857583 100 µL

L12R1 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
RCAS1; EBAG9 Protein (N-His, Human)
P517996 100 µg

RCAS1; EBAG9 Protein (N-His, Human)

Sign In for Pricing
View Details
p38 alpha (MAP Kinase) Antibody: ATTO 488
MBS800542-01 0.1 mg

p38 alpha (MAP Kinase) Antibody: ATTO 488

Sign In for Pricing
View Details
p38 alpha (MAP Kinase) Antibody: ATTO 488
MBS800542-02 5x 0.1 mg

p38 alpha (MAP Kinase) Antibody: ATTO 488

Sign In for Pricing
View Details