ATF7 Peptide - middle region
ATF7 Peptide - middle region
Product Specifications
Product Name Alternative
ATF7, ATFA
UniProt
P17544
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATF7 Rabbit Polyclonal Antibody (orb331473) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940417-500 1x 500 µL
Fascin-1 (FSCN1/417), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683802-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/3802), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473135-500 1x 500 µL
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3135R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details