Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCO1 Peptide - N-terminal region

BCO1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCO, BCDO, BCMO, BCDO1, BCMO1

UniProt

Q9HAY6

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCO1 Rabbit Polyclonal Antibody (orb588222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059125

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNVLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Methyl-dl-valine, HCl
459437-01 100 mg

N-Methyl-dl-valine, HCl

Sign In for Pricing
View Details
N-Methyl-dl-valine, HCl
459437-02 250 mg

N-Methyl-dl-valine, HCl

Sign In for Pricing
View Details
DOPEY2 Protein Vector (Mouse) (pPB-N-His)
PV173163 500 ng

DOPEY2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
TLR2 (Toll-like Receptor 2, CD282, TIL4) (MaxLight 550)
MBS6219700-01 0.1 mL

TLR2 (Toll-like Receptor 2, CD282, TIL4) (MaxLight 550)

Sign In for Pricing
View Details
TLR2 (Toll-like Receptor 2, CD282, TIL4) (MaxLight 550)
MBS6219700-02 5x 0.1 mL

TLR2 (Toll-like Receptor 2, CD282, TIL4) (MaxLight 550)

Sign In for Pricing
View Details
STAT2 Rabbit Monoclonal Antibody
E49Y5866 100 µL

STAT2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details