CACNB1 Peptide - middle region
CACNB1 Peptide - middle region
Product Specifications
Product Name Alternative
CACNB1, CACNLB1
UniProt
Q02641
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CACNB1 Rabbit Polyclonal Antibody (orb588226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A602065-250MG 250 mg
2-Amino-4'-bromoacetophenone Hydrochloride
Sign In for Pricing
View Details 
E-MSEL-M0044-01 24 Tests
Mini Sample Mouse IgM (Immunoglobulin M) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0044-02 48 Tests
Mini Sample Mouse IgM (Immunoglobulin M) ELISA Kit
Sign In for Pricing
View Details E-MSEL-M0044-03 96 Tests
Mini Sample Mouse IgM (Immunoglobulin M) ELISA Kit
Sign In for Pricing
View Details 
BNC680923-500 1x 500 µL
Myosin, Smooth Muscle Heavy Chain (MYH11/923), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details