Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNB1 Peptide - middle region

CACNB1 Peptide - middle region

Product Specifications

Product Name Alternative

CACNB1, CACNLB1

UniProt

Q02641

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CACNB1 Rabbit Polyclonal Antibody (orb588226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSSSLGDVVTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)
TRC-D638870-100MG 100 mg

1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)

Sign In for Pricing
View Details
RAD51 Mouse Monoclonal Antibody [Clone ID: 13E4]
AM20858PU-N 50 µL

RAD51 Mouse Monoclonal Antibody [Clone ID: 13E4]

Sign In for Pricing
View Details
Fluchloraminopyr
TRC-F353960-100MG 100 mg

Fluchloraminopyr

Sign In for Pricing
View Details
(2R)-Vildagliptin
TRC-V305005-250MG 250 mg

(2R)-Vildagliptin

Sign In for Pricing
View Details
Frozen Tissue Blocks, Muscle tissue
CB513523 1 Block

Frozen Tissue Blocks, Muscle tissue

Sign In for Pricing
View Details
AzoDye-3 Alkyne
2484-AAT 1 mg

AzoDye-3 Alkyne

Sign In for Pricing
View Details