CAMK1D Peptide - N-terminal region
CAMK1D Peptide - N-terminal region
Product Specifications
Product Name Alternative
CAMK1D, CAMKID
UniProt
Q8IU85
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CAMK1D Rabbit Polyclonal Antibody (orb331477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_705718
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-LDL-Hu-01 96 Tests
Human Low Density Lipoprotein (LDL) ELISA Kit
Sign In for Pricing
View Details RD-LDL-Hu-02 48 Tests
Human Low Density Lipoprotein (LDL) ELISA Kit
Sign In for Pricing
View Details 
TA367304 100 µL
Thymosin beta 10 (TMSB10) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details TPD50434-01 50 mg
Rac-N-[ (3R,4S) -4- (1-Methyl-1H-imidazol-2-yl) pyrrolidin-3-yl]acetamide dihydrochloride
Sign In for Pricing
View Details TPD50434-02 0.5 g
Rac-N-[ (3R,4S) -4- (1-Methyl-1H-imidazol-2-yl) pyrrolidin-3-yl]acetamide dihydrochloride
Sign In for Pricing
View Details 
DLR-WNT11-Hu-48T 48 Tests
Human Wingless Type MMTV Integration Site Family, Member 11 (WNT11) ELISA Kit
Sign In for Pricing
View Details