Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMK1D Peptide - N-terminal region

CAMK1D Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAMK1D, CAMKID

UniProt

Q8IU85

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAMK1D Rabbit Polyclonal Antibody (orb331477) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_705718

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Delta Like 1 Homolog (dLK1) BioAssayTM ELISA Kit (Human)
024619 96 Tests

Delta Like 1 Homolog (dLK1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
XRCC3 Antibody
E11-13130C 100 µg

XRCC3 Antibody

Sign In for Pricing
View Details
HYAL1
CSB-CL623651HU 10 μg Plasmid + 200 μL Glycerol

HYAL1

Sign In for Pricing
View Details
Human Mucin 1, MUC1 ELISA Kit
GTR10479356-01 48 Well

Human Mucin 1, MUC1 ELISA Kit

Sign In for Pricing
View Details
Human Mucin 1, MUC1 ELISA Kit
GTR10479356-02 96 Well

Human Mucin 1, MUC1 ELISA Kit

Sign In for Pricing
View Details
Human Mucin 1, MUC1 ELISA Kit
GTR10479356-03 192 Well

Human Mucin 1, MUC1 ELISA Kit

Sign In for Pricing
View Details