Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZB Peptide - N-terminal region

CAPZB Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAPZB

UniProt

P47756

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPZB Rabbit Polyclonal Antibody (orb331478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse AMY2A3 shRNA Plasmid
abx984313-01 150 µg

Mouse AMY2A3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse AMY2A3 shRNA Plasmid
abx984313-02 300 µg

Mouse AMY2A3 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant Human TSPY-like protein 2
BP2375-50ug 50 µg

Recombinant Human TSPY-like protein 2

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.01 (SPCC191.01, SPCC417.13)
MBS1066919-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.01 (SPCC191.01, SPCC417.13)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.01 (SPCC191.01, SPCC417.13)
MBS1066919-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.01 (SPCC191.01, SPCC417.13)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.01 (SPCC191.01, SPCC417.13)
MBS1066919-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C191.01 (SPCC191.01, SPCC417.13)

Sign In for Pricing
View Details