Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZB Peptide - N-terminal region

CAPZB Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAPZB

UniProt

P47756

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPZB Rabbit Polyclonal Antibody (orb331478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF641 (NM_152320) AAV Particle
RC216576A1V 250 µL

Human ZNF641 (NM_152320) AAV Particle

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB511887 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
IRF5 (NM_002200) Human Tagged Lenti ORF Clone
RC212461L1 10 µg

IRF5 (NM_002200) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tau (MAPT) (NM_016841) Human Recombinant Protein
PH36378M5 20 µg

Tau (MAPT) (NM_016841) Human Recombinant Protein

Sign In for Pricing
View Details
Choline kinase alpha (CHKA) Human Over-expression Lysate
orb1378968 20 µg

Choline kinase alpha (CHKA) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human AHNAK2 Protein, N-His-SUMO
orb2963901-01 50 µg

Recombinant Human AHNAK2 Protein, N-His-SUMO

Sign In for Pricing
View Details