Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZB Peptide - N-terminal region

CAPZB Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAPZB

UniProt

P47756

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPZB Rabbit Polyclonal Antibody (orb331478) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastric Inhibitory Polypeptide (GIP)
MBS601881-01 0.1 mL

Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide (GIP)
MBS601881-02 5x 0.1 mL

Gastric Inhibitory Polypeptide (GIP)

Sign In for Pricing
View Details
RINT-1 Lentiviral Activation Particles (h2)
sc-407428-LAC-2 200 µL

RINT-1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
TEPSIN Antibody - N-terminal region : FITC (ARP68138_P050-FITC)
ARP68138_P050-FITC 100 µL

TEPSIN Antibody - N-terminal region : FITC (ARP68138_P050-FITC)

Sign In for Pricing
View Details
Fmoc-N-methyl-O-tert-butyl-L-threonine
277402-01 500 mg

Fmoc-N-methyl-O-tert-butyl-L-threonine

Sign In for Pricing
View Details
Fmoc-N-methyl-O-tert-butyl-L-threonine
277402-02 1 g

Fmoc-N-methyl-O-tert-butyl-L-threonine

Sign In for Pricing
View Details