Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD22 Peptide - N-terminal region

CD22 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD22

UniProt

P20273

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD22 Rabbit Polyclonal Antibody (orb588230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001762

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human LIG3 PolyClonal Antibody
MBS1489230-01 0.1 mL

Rabbit Anti Human LIG3 PolyClonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human LIG3 PolyClonal Antibody
MBS1489230-02 5x 0.1 mL

Rabbit Anti Human LIG3 PolyClonal Antibody

Sign In for Pricing
View Details
RAB11FIP4 Mouse Monoclonal Antibody [Clone ID: OTI13B5]
CF808377 100 µg

RAB11FIP4 Mouse Monoclonal Antibody [Clone ID: OTI13B5]

Sign In for Pricing
View Details
FAM26D sgRNA CRISPR Lentivector (Human) (Target 2)
K0719003 1.0 µg DNA

FAM26D sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Podoplanin Rabbit Polyclonal Antibody
E53P01401 100 µL

Podoplanin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pseudomonas aeruginosa (ATCC® derived CultiControl)
89033 1 Vial

Pseudomonas aeruginosa (ATCC® derived CultiControl)

Sign In for Pricing
View Details