CDK3 Peptide - N-terminal region
CDK3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CDK3, CDKN3
UniProt
Q00526
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDK3 Rabbit Polyclonal Antibody (orb588232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001249
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI1G6]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d9f/imageurl/cf812566.webp)
CF812566 100 µg
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
Sign In for Pricing
View Details 
AP05284SU-N 100 µg
Ceramide synthase 2 (CERS2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
LA-8003-1 1 mg
Alkaline Phosphatase Conjugated Aegopodium podagraria Lectin (Ground Elder) -APP-
Sign In for Pricing
View Details 
