Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK3 Peptide - N-terminal region

CDK3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDK3, CDKN3

UniProt

Q00526

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDK3 Rabbit Polyclonal Antibody (orb588232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001249

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf93 Human Gene Knockout Kit (CRISPR)
KN429195 1 Kit

C10orf93 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT5A pSer780 Rabbit Polyclonal Antibody
AP02348PU-N 100 µL

STAT5A pSer780 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AP-4 complex subunit sigma Rabbit Polyclonal Antibody
HA500449 100 µL

AP-4 complex subunit sigma Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cela3b Mouse Gene Knockout Kit (CRISPR)
KN503112 1 Kit

Cela3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD 312236, PD 312237 Mixture
TRC-P217850-1MG 1 mg

PD 312236, PD 312237 Mixture

Sign In for Pricing
View Details
4,5-Dihydro-1H-pyrazol-3-amine Hydrochloride
TRC-D217655-2.5G 2.5 g

4,5-Dihydro-1H-pyrazol-3-amine Hydrochloride

Sign In for Pricing
View Details